PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC004408.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family bHLH
Protein Properties Length: 253aa    MW: 28366.5 Da    PI: 8.6331
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC004408.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH43.84.6e-1473125155
                   CHHHHHHHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHHH CS
           HLH   1 rrrahnerErrRRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksLq 55 
                   ++ +hn+ Er RR+++N  +++Lr+llP a   + kKls  +++ +A +YI ++q
  EcC004408.10  73 KKLSHNASERDRRKKMNGLYSTLRSLLPAA--DRMKKLSIPTMVSRALKYIPEMQ 125
                   6789*************************6..49999**************9988 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088814.22172124IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SuperFamilySSF474591.01E-1573142IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000102.1E-1173125IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
CDDcd000832.39E-1473129No hitNo description
Gene3DG3DSA:4.10.280.101.3E-1473143IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SMARTSM003532.9E-1078130IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 253 aa     Download sequence    Send to blast
MLSFSPSGWP LEDSTSHEQW SHMHRDAYTC YSPPLLRFPF SSPPTLSPPA DLALDPLDVP  60
FGGAKGEEAT MVKKLSHNAS ERDRRKKMNG LYSTLRSLLP AADRMKKLSI PTMVSRALKY  120
IPEMQQQVEK LTQEKEKLLS RINASRDGDY YTSHQEISRG KGSLQILVPS ISTTRLSESE  180
VAIQISTRKA MTHKTVDFFE VLLALDYLGF PVISSSTFES CGGMKTTFYN LHVQVVGEIL  240
VKSFEVDKTF PSV
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010036348.11e-157PREDICTED: transcription factor ORG2-like
TrEMBLA0A059D2E51e-107A0A059D2E5_EUCGR; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM48228153
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56970.11e-40bHLH family protein